PDB entry 1e6y

View 1e6y on RCSB PDB site
Description: methyl-coenzyme m reductase from methanosarcina barkeri
Deposited on 2000-08-23, released 2000-10-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-01, with a file datestamp of 2000-12-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yA (A:)
    aadifskfkkdmevkfaqefgsnkqtggditdktakflrlgpeqdprkvemikagkeiae
    krgiafynpmmhsgaplgqraitpytisgtdivcepddlhyvnnaamqqmwddirrtciv
    gldmahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpalvddcyvkvft
    gddaladeidkqflidinkefseeqaaqikasigktswqaihiptivsrttdgaqtsrwa
    amqigmsfisayamcageaavadlsfaakhaalvsmgemlparrargpnepgglsfghls
    divqtsrvsedpakialevvgagcmlydqiwlgsymsggvgftqyataaytddildnnty
    ydvdyindkyngaatvgkdnkvkaslevvkdiatestlygietyekfptaledhfggsqr
    atvlaaaagvacslatgnanaglsgwylsmylhkeawgrlgffgfdlqdqcgatnvlsyq
    gdeglpdelrgpnypnyamnvghqggyagiaqaahsgrgdaftvnpllkvcfaddllpfn
    faeprrefgrgairefvpagerslvipa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yB (B:)
    sdtvdiyddrgkllesnvdimslaptrnaaiqsiimdtkrsvavnlagiqgalasgkmgg
    kgrqilgrglnydivgnadaiaenvkklvqvdegddtnvikvkggkslliqspksriiag
    adfmsattvgaaavtqtimdmfgtdpydapivksavwgsypqtmdlmggqvqgilsipqn
    neglgfslrnimanhvaaisnrnamnasalssiyeqsgifemggavgmferhqllglayq
    glnannllydivkengkdgtigtviesvvrraieagiisvdktapsgynfykandvpkwn
    acaavgtlaatlvncgagraaqnvsstllyfndileketglpgcdygkvegtavgfsffs
    hsiyggggpgvfngnhvvtrhsrgfaipcvcaavaldagtqmfsiestsgligdvfgaip
    efrepikavagv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yC (C:)
    ayerqyypgatsvaanrrkhmsgkleklreisdedltavlghrapgsdypsthpplaemg
    epacstrenvaatpgaaagdrvryiqfadsmynapatpyfrsyfaainfrgvdpgtlsgr
    qivearerdmeqcakvqmeteitdhalagvrgatvhghsvrlqedgvmfdmldrrrleng
    tiimdkdqvaipldrkvdlgkpmsseeaakrttiyrvdnvafrddaevvewvhrifdqrt
    kfgfqpk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yD (D:)
    aadifskfkkdmevkfaqefgsnkqtggditdktakflrlgpeqdprkvemikagkeiae
    krgiafynpmmhsgaplgqraitpytisgtdivcepddlhyvnnaamqqmwddirrtciv
    gldmahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpalvddcyvkvft
    gddaladeidkqflidinkefseeqaaqikasigktswqaihiptivsrttdgaqtsrwa
    amqigmsfisayamcageaavadlsfaakhaalvsmgemlparrargpnepgglsfghls
    divqtsrvsedpakialevvgagcmlydqiwlgsymsggvgftqyataaytddildnnty
    ydvdyindkyngaatvgkdnkvkaslevvkdiatestlygietyekfptaledhfggsqr
    atvlaaaagvacslatgnanaglsgwylsmylhkeawgrlgffgfdlqdqcgatnvlsyq
    gdeglpdelrgpnypnyamnvghqggyagiaqaahsgrgdaftvnpllkvcfaddllpfn
    faeprrefgrgairefvpagerslvipa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yE (E:)
    sdtvdiyddrgkllesnvdimslaptrnaaiqsiimdtkrsvavnlagiqgalasgkmgg
    kgrqilgrglnydivgnadaiaenvkklvqvdegddtnvikvkggkslliqspksriiag
    adfmsattvgaaavtqtimdmfgtdpydapivksavwgsypqtmdlmggqvqgilsipqn
    neglgfslrnimanhvaaisnrnamnasalssiyeqsgifemggavgmferhqllglayq
    glnannllydivkengkdgtigtviesvvrraieagiisvdktapsgynfykandvpkwn
    acaavgtlaatlvncgagraaqnvsstllyfndileketglpgcdygkvegtavgfsffs
    hsiyggggpgvfngnhvvtrhsrgfaipcvcaavaldagtqmfsiestsgligdvfgaip
    efrepikavagvl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6yF (F:)
    ayerqyypgatsvaanrrkhmsgkleklreisdedltavlghrapgsdypsthpplaemg
    epacstrenvaatpgaaagdrvryiqfadsmynapatpyfrsyfaainfrgvdpgtlsgr
    qivearerdmeqcakvqmeteitdhalagvrgatvhghsvrlqedgvmfdmldrrrleng
    tiimdkdqvaipldrkvdlgkpmsseeaakrttiyrvdnvafrddaevvewvhrifdqrt
    kfgfqpk