PDB entry 1e6t

View 1e6t on RCSB PDB site
Description: ms2-RNA hairpin (5bru-5) complex
Class: complex (capsid protein/RNA hairpin)
Keywords: complex (capsid protein/RNA hairpin), hairpin, capsid, levivirus
Deposited on 2000-08-22, released 2000-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-11-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6ta_
  • Chain 'B':
    Compound: coat protein
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6tb_
  • Chain 'C':
    Compound: coat protein
    Species: BACTERIOPHAGE MS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6tc_
  • Chain 'R':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up* (bro)up*ap*cp*cp*cp*ap*up*gp*u)-3')
  • Chain 'S':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up* (bro)up*ap*cp*cp*cp*ap*up*gp*u)-3')
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6tA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6tB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6tC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.