PDB entry 1e6s

View 1e6s on RCSB PDB site
Description: MYROSINASE FROM SINAPIS ALBA with bound gluco-hydroximolactam and sulfate
Class: hydrolase
Keywords: hydrolase, family 1 glycosyl hydrolase, glucosinolate, tim barrel, inhibitor, transition state analogue
Deposited on 2000-08-23, released 2000-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: myrosinase ma1
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6sm_
  • Heterogens: NAG, FUC, BMA, XYP, MAN, GOX, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1e6sM (M:)
    deeitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypn
    ksgpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidy
    yhglisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvk
    ywltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdl
    yrknythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimi
    dtvgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyi
    nasghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenr
    nqsmldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidw
    nnvtdrdlkksgqwyqsfisp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6sM (M:)
    eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
    gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
    glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
    ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
    knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
    vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
    sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
    smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
    vtdrdlkksgqwyqsfisp