PDB entry 1e6r

View 1e6r on RCSB PDB site
Description: chitinase b from serratia marcescens wildtype in complex with inhibitor allosamidin
Class: hydrolase
Keywords: hydrolase, chitin degradation, inhibitor allosamidin
Deposited on 2000-08-22, released 2001-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6ra1, d1e6ra2, d1e6ra3
  • Chain 'B':
    Compound: chitinase b
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6rb1, d1e6rb2, d1e6rb3
  • Heterogens: AMI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6rA (A:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6rA (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e6rB (B:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6rB (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva