PDB entry 1e6o

View 1e6o on RCSB PDB site
Description: crystal structure of fab13b5 against hiv-1 capsid protein p24
Class: immunoglobulin
Keywords: fab, antibody, antigen, hiv-1, p24, ca
Deposited on 2000-08-21, released 2000-11-27
The last revision prior to the SCOP 1.73 freeze date was dated 2000-11-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAC28910 (6-218)
      • conflict (8)
      • conflict (12)
      • conflict (30)
      • conflict (32)
      • conflict (57-58)
      • conflict (65)
      • conflict (71)
      • conflict (81)
      • conflict (83)
      • conflict (96)
      • insertion (98-99)
      • conflict (100-105)
      • conflict (113)
      • conflict (119)
    Domains in SCOP 1.73: d1e6oh1, d1e6oh2
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (1-End)
      • conflict (10-11)
      • conflict (14)
      • conflict (16-17)
      • conflict (20)
      • conflict (25)
      • conflict (44)
      • conflict (48-49)
      • conflict (83)
      • conflict (90-91)
      • conflict (93)
      • conflict (97)
      • conflict (110)
    Domains in SCOP 1.73: d1e6ol1, d1e6ol2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6oH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1e6oL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6oL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn