PDB entry 1e6o

View 1e6o on RCSB PDB site
Description:
Deposited on 2000-08-21, released 2000-11-27
The last revision prior to the SCOP 1.65 freeze date was dated 2000-11-27, with a file datestamp of 2000-11-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e6oh1, d1e6oh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e6ol1, d1e6ol2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6oH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1e6oL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6oL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn