PDB entry 1e6m

View 1e6m on RCSB PDB site
Description: two-component signal transduction system d57a mutant of chey
Class: signaling protein
Keywords: signaling protein, two-component signal transduction system, chemotaxis, active site mutant
Deposited on 2000-08-18, released 2000-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli K-12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE67 (0-127)
      • cloning artifact (0)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d1e6ma1, d1e6ma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6mA (A:)
    sdkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisawnmp
    nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm