PDB entry 1e6l

View 1e6l on RCSB PDB site
Description: two-component signal transduction system d13a mutant of chey
Deposited on 2000-08-18, released 2001-03-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-03-05, with a file datestamp of 2001-03-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1e6la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6lA (A:)
    dkelkflvvdafstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
    mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
    ifeklgm