PDB entry 1e6l

View 1e6l on RCSB PDB site
Description: two-component signal transduction system d13a mutant of chey
Class: signaling protein
Keywords: signaling protein, two-component signal transduction system, chemotaxis, active site mutant
Deposited on 2000-08-18, released 2001-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-126)
      • engineered (10)
    Domains in SCOPe 2.07: d1e6la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6lA (A:)
    dkelkflvvdafstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
    mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
    ifeklgm