PDB entry 1e6l

View 1e6l on RCSB PDB site
Description: Two-component signal transduction system D13A mutant of CheY
Class: signaling protein
Keywords: signaling protein, two-component signal transduction system, chemotaxis, active site mutant
Deposited on 2000-08-18, released 2001-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Gene: cheY, b1882, JW1871
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-126)
    • engineered mutation (10)
  Domains in SCOPe 2.08: d1e6la_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e6lA (A:)
  dkelkflvvdafstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmpn
  mdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleeklnk
  ifeklgm