PDB entry 1e6k

View 1e6k on RCSB PDB site
Description: two-component signal transduction system d12a mutant of chey
Class: signaling protein
Keywords: signaling protein, two-component signal transduction system, chemotaxis, active site mutant
Deposited on 2000-08-18, released 2001-03-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 1E6K (0-1)
    • cloning artifact (2)
    • engineered (12)
  • Uniprot P06143 (2-129)
  Domains in SCOPe 2.07: d1e6ka_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e6kA (A:)
  mrsdkelkflvvadfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwn
  mpnmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleek
  lnkifeklgm