PDB entry 1e6j

View 1e6j on RCSB PDB site
Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Class: Viral protein/Immune system
Keywords: p24, fab, hiv-1, virus assembly, capsid, ca, antigen, antibody, protein-protein interactions
Deposited on 2000-08-18, released 2000-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-11, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAC28910 (6-218)
      • conflict (8)
      • conflict (12)
      • conflict (30)
      • conflict (32)
      • conflict (57-58)
      • conflict (65)
      • conflict (71)
      • conflict (81)
      • conflict (83)
      • conflict (96)
      • insertion (98-99)
      • conflict (100-105)
      • conflict (113)
      • conflict (119)
    Domains in SCOP 1.75: d1e6jh1, d1e6jh2
  • Chain 'L':
    Compound: immunoglobulin
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (1-209)
      • conflict (10-11)
      • conflict (14)
      • conflict (16-17)
      • conflict (20)
      • conflict (25)
      • conflict (44)
      • conflict (48-49)
      • conflict (83)
      • conflict (90-91)
      • conflict (93)
      • conflict (97)
      • conflict (110)
    Domains in SCOP 1.75: d1e6jl1, d1e6jl2
  • Chain 'P':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (isolate 12)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e6jp1, d1e6jp2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jP (P:)
    vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
    etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetll
    vqnanpdcktilkalgpaatleemmtacqg