PDB entry 1e6j

View 1e6j on RCSB PDB site
Description:
Deposited on 2000-08-18, released 2000-11-27
The last revision prior to the SCOP 1.65 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e6jh1, d1e6jh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e6jl1, d1e6jl2
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1e6jp1, d1e6jp2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jP (P:)
    vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
    etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetll
    vqnanpdcktilkalgpaatleemmtacqg