PDB entry 1e6j

View 1e6j on RCSB PDB site
Description: Crystal structure of HIV-1 capsid protein (p24) in complex with Fab13B5
Class: viral protein
Keywords: hiv capsid protein (p24), p24, fab, hiv-1, virus assembly, capsid, ca, antigen, antibody, protein-protein interactions, viral protein
Deposited on 2000-08-18, released 2000-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E6J (0-218)
    Domains in SCOPe 2.07: d1e6jh1, d1e6jh2
  • Chain 'L':
    Compound: immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E6J (0-209)
    Domains in SCOPe 2.07: d1e6jl1, d1e6jl2
  • Chain 'P':
    Compound: capsid protein p24
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6jp1, d1e6jp2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jP (P:)
    vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
    etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetll
    vqnanpdcktilkalgpaatleemmtacqg