PDB entry 1e6i

View 1e6i on RCSB PDB site
Description: Bromodomain from GCN5 complexed with acetylated H4 peptide
Class: gene regulation
Keywords: gene regulation, histone binding, n-acetyl lysine
Deposited on 2000-08-18, released 2000-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional activator gcn5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCN5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1e6ia_
  • Chain 'P':
    Compound: histone h4
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1e6iA (A:)
amaniaqrpkrgphdaaiqniltelqnhaaawpflqpvnkeevpdyydfikepmdlstme
iklesnkyqkmedfiydarlvfnncrmyngentsyykyanrlekffnnkvkeipeyshli
d

    Sequence, based on observed residues (ATOM records): (download) 
    >1e6iA (A:)
rgphdaaiqniltelqnhaaawpflqpvnkeevpdyydfikepmdlstmeiklesnkyqk
medfiydarlvfnncrmyngentsyykyanrlekffnnkvkeipeyshlid

  • Chain 'P':
    No sequence available.