PDB entry 1e6h

View 1e6h on RCSB PDB site
Description: a-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Deposited on 2000-08-17, released 2001-03-07
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-23, with a file datestamp of 2002-05-23.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.257
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e6ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6hA (A:)
    mdetgkelvlvlydyqeksprevtikkgdiltllnstnkdwwkievndrqgfvpaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6hA (A:)
    detgkelvlvlydyqeksprevtikkgdiltllnstnkdwwkievndrqgfvpaaylkkl
    d