PDB entry 1e6g

View 1e6g on RCSB PDB site
Description: a-spectrin sh3 domain a11v, v23l, m25i, v53i, v58l mutant
Class: sh3-domain
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding
Deposited on 2000-08-15, released 2001-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.267
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: GALLUS GALLUS [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-61)
      • engineered (10)
      • engineered (22)
      • engineered (24)
      • engineered (52)
      • engineered (57)
    Domains in SCOPe 2.07: d1e6ga_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6gA (A:)
    mdetgkelvlvlydyqekspreltikkgdiltllnstnkdwwkvevndrqgfipaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6gA (A:)
    tgkelvlvlydyqekspreltikkgdiltllnstnkdwwkvevndrqgfipaaylkkld