PDB entry 1e6f

View 1e6f on RCSB PDB site
Description: Human MIR-receptor, repeat 11
Class: receptor
Keywords: receptor, mir-receptor, igf-II receptor, transport, glycoprotein
Deposited on 2000-08-15, released 2001-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e6fa_
  • Chain 'B':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e6fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6fA (A:)
    mksnehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacf
    gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
    sldkqtctlffswhtplaceqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6fA (A:)
    ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
    vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpnrpmlisldkqtctlff
    swhtplace
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e6fB (B:)
    mksnehddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacf
    gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
    sldkqtctlffswhtplaceqat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6fB (B:)
    ddcqvtnpstghlfdlsslsgragftaaysekglvymsicgenencppgvgacfgqtris
    vgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpenrpmlisldkqtctlf
    fswhtplaceq