PDB entry 1e6b

View 1e6b on RCSB PDB site
Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana
Class: transferase
Keywords: transferase
Deposited on 2000-08-10, released 2001-06-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1e6ba1, d1e6ba2
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6bA (A:)
    mansgeeklklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtv
    palvdgdvvindsfaiimyldekypeppllprdlhkravnyqamsivlsgiqphqnlavi
    ryieekinveektawvnnaitkgftalekllvncagkhatgdeiyladlflapqihgain
    rfqinmepyptlakcyesynelpafqnalpekqpdapssti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6bA (A:)
    klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
    vvindsfaiimyldekypeppllprdlhkravnyqamsivlsgiqptawvnnaitkgfta
    lekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafq
    nalpekqpdapsst