PDB entry 1e6a

View 1e6a on RCSB PDB site
Description: fluoride-inhibited substrate complex of saccharomyces cerevisiae inorganic pyrophosphatase
Class: phosphoryl transfer
Keywords: phosphoryl transfer, hydrolysis
Deposited on 2000-08-09, released 2001-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6aa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6ab_
  • Heterogens: MN, POP, F, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6aA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6aA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e6aB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6aB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtkkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaslkadapidksidkwffi