PDB entry 1e68

View 1e68 on RCSB PDB site
Description: solution structure of bacteriocin as-48
Class: antibiotic
Keywords: antibiotic, bacteriocins, cationic antibacterial peptides, five-helix globule, cyclic polypeptide
Deposited on 2000-08-09, released 2000-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: as-48 protein
  Species: Enterococcus faecalis [TaxId:1351]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q47765 (0-69)
  Domains in SCOPe 2.08: d1e68a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e68A (A:)
  makefgipaavagtvlnvveaggwvttivsiltavgsgglsllaaagresikaylkkeik
  kkgkraviaw