PDB entry 1e5y

View 1e5y on RCSB PDB site
Description:
Deposited on 2000-08-04, released 2000-08-19
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-19, with a file datestamp of 2000-08-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.161
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1e5ya_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1e5yb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1e5yc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1e5yd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5yA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5yB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5yC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5yD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk