PDB entry 1e5x

View 1e5x on RCSB PDB site
Description: structure of threonine synthase from arabidopsis thaliana
Deposited on 2000-08-04, released 2001-08-02
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-02, with a file datestamp of 2001-08-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1e5xa_
  • Chain 'B':
    Domains in SCOP 1.59: d1e5xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5xA (A:)
    ietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesysldeivyrsrsgg
    lldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafeg
    nsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgc
    astgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklir
    eitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkm
    cqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqigdpvsidrav
    yalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgviaptdrtvv
    vstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylgsntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5xA (A:)
    ietavkpphrtednirdenavnpfsakyvpfnaapgstesysldeivyrglldvehdmea
    lkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerf
    gkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaal
    saycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiyl
    anslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdri
    prmvcaqaananplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqad
    stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
    rfsnppvdvkadfgavmdvlksylgsntlts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5xB (B:)
    phrtednirdearrnrsnavnpfsakyvpfnaapgstesysldeivyrsrsgglldvehd
    mealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwa
    erfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdts
    aalsaycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelp
    iylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglv
    driprmvcaqaananplylhyksgwkdfkpmtasttfasaiqigdpvsidravyalkkcn
    giveeateeelmdamaqadstgmficphtgvaltalfklrnqgviaptdrtvvvstahgl
    kftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5xB (B:)
    phrtednirdevnpfsakyvpfnaapgstesysldeivglldvehdmealkrfdgaywrd
    lfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlw
    vkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagips
    ivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrleg
    qktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaana
    nplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqadstgmficphtg
    valtalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvka
    dfgavmdvlksyl