PDB entry 1e5w

View 1e5w on RCSB PDB site
Description: Structure of isolated FERM domain and first long helix of moesin
Deposited on 2000-08-03, released 2001-06-27
The last revision prior to the SCOP 1.69 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.254
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5wA (A:)
    mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlk
    lnkkvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppe
    tavllasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehr
    gmlredavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdti
    evqqmkaqareekhqkqmeramlenekkkremaekekekierekee