PDB entry 1e5v

View 1e5v on RCSB PDB site
Description: oxidized dmso reductase exposed to hepes buffer
Class: oxidoreductase
Keywords: oxidoreductase, reductase, dmso, molybdopterin
Deposited on 2000-08-03, released 2000-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dimethyl sulfoxide/trimethylamine N-oxide reductase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52675 (Start-822)
      • conflict (80)
      • conflict (84)
      • conflict (148)
      • conflict (275)
      • conflict (277)
      • conflict (321)
      • conflict (335-336)
      • conflict (353)
      • conflict (415)
      • conflict (497)
      • conflict (567)
      • conflict (593)
      • conflict (596)
    Domains in SCOPe 2.08: d1e5va1, d1e5va2
  • Chain 'C':
    Compound: Dimethyl sulfoxide/trimethylamine N-oxide reductase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52675 (Start-822)
      • conflict (80)
      • conflict (84)
      • conflict (148)
      • conflict (275)
      • conflict (277)
      • conflict (321)
      • conflict (335-336)
      • conflict (353)
      • conflict (415)
      • conflict (497)
      • conflict (567)
      • conflict (593)
      • conflict (596)
    Domains in SCOPe 2.08: d1e5vc1, d1e5vc2
  • Heterogens: PGD, 2MO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5vA (A:)
    mtkfsgnelraelyrraflsysvapgalgmfgrsllakgaraealangtvmsgshwgvft
    atvengrataftpwekdphpspmlagvldsiysptrikypmvrreflekgvnadrstrgn
    gdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlhncttllrrmltlagg
    yvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvfwaadpiktsqigwvi
    pehgaypglealkakgtkvividpvrtktveffgaehitpkpqtdvaimlgmahtlvaed
    lydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaetikelarlfeskrtml
    aagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgggtpstsgpalagitd
    ggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpfvh
    hqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgilam
    kkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqmpa
    fdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcpah
    ptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaa
    rgiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnv
    lsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5vA (A:)
    langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
    eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
    hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
    fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
    dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
    tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
    ggtpstsgpalagitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
    fvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgi
    lamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvq
    mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
    pahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpdd
    aaargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygd
    vnvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e5vC (C:)
    mtkfsgnelraelyrraflsysvapgalgmfgrsllakgaraealangtvmsgshwgvft
    atvengrataftpwekdphpspmlagvldsiysptrikypmvrreflekgvnadrstrgn
    gdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrlhncttllrrmltlagg
    yvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmvfwaadpiktsqigwvi
    pehgaypglealkakgtkvividpvrtktveffgaehitpkpqtdvaimlgmahtlvaed
    lydkdfianytsgfdkflpyldgetdstpktaewaegisgvpaetikelarlfeskrtml
    aagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysgggtpstsgpalagitd
    ggaatkgpewlaasgasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnpfvh
    hqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgilam
    kkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvqmpa
    fdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddcpah
    ptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpddaaa
    rgiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygdvnv
    lsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5vC (C:)
    langtvmsgshwgvftatvengrataftpwekdphpspmlagvldsiysptrikypmvrr
    eflekgvnadrstrgngdfvrvswdqaldlvaaevkrveetygpegvfggsygwkspgrl
    hncttllrrmltlaggyvngagdystgaaqvimphvvgtlevyeqqtawpvlaentevmv
    fwaadpiktsqigwvipehgaypglealkakgtkvividpvrtktveffgaehitpkpqt
    dvaimlgmahtlvaedlydkdfianytsgfdkflpyldgetdstpktaewaegisgvpae
    tikelarlfeskrtmlaagwsmqrmhhgeqahwmlvtlasmlgqiglpgggfglsyhysg
    ggtpstsgpalagitdggasvipvarvvdmlenpgaefdfngtrskfpdvkmaywvggnp
    fvhhqdrnrmvkawekletfvvhdfqwtptarhadivlpattsyerndietigdysntgi
    lamkkiveplyearsdydifaavaerlgkgaeftegkdemgwiksfyddaakqgkaagvq
    mpafdafwaegivefpvtdgadfvryasfredpllnplgtptglieiyskniekmgyddc
    pahptwmeplerldgpgakyplhiaashpfnrlhsqlngtvlregyavqghepclmhpdd
    aaargiadgdvvrvhndrgqiltgvkvtdavmkgviqiyeggwydpsdvtepgtldkygd
    vnvlsadigtsklaqgncgqtvlaevekytgpavtltgfvapkaae