PDB entry 1e5u

View 1e5u on RCSB PDB site
Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Class: intimin
Keywords: intimin, escherichia coli, cell adhesion, outer membrane protein, nmr spectroscopy
Deposited on 2000-08-02, released 2000-08-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: intimin
  Species: ESCHERICHIA COLI [TaxId:562]
  Gene: EAE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19809 (0-186)
  Domains in SCOPe 2.03: d1e5ui1, d1e5ui2

PDB Chain Sequences:

• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e5uI (I:)
  tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
  tlkekgtttisvissdnqtatytiatpnslivpnmskrvtyndavntcknfggklpssqn
  elenvfkawgaankyeyykssqtiiswvqqtaqdaksgvastydlvkqnplnnikasesn
  ayatcvk