PDB entry 1e5u

View 1e5u on RCSB PDB site
Description: nmr representative structure of intimin-190 (int190) from enteropathogenic e. coli
Class: intimin
Keywords: intimin, escherichia coli, cell adhesion, outer membrane protein, nmr spectroscopy
Deposited on 2000-08-02, released 2000-08-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: intimin
    Species: ESCHERICHIA COLI [TaxId:562]
    Gene: EAE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1e5ui1, d1e5ui2

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5uI (I:)
    tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
    tlkekgtttisvissdnqtatytiatpnslivpnmskrvtyndavntcknfggklpssqn
    elenvfkawgaankyeyykssqtiiswvqqtaqdaksgvastydlvkqnplnnikasesn
    ayatcvk