PDB entry 1e5s

View 1e5s on RCSB PDB site
Description: proline 3-hydroxylase (type II) - iron form
Class: oxygenase
Keywords: oxygenase, 2-oxoglutarate dependent oxygenase
Deposited on 2000-07-28, released 2001-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline oxidase
    Species: STREPTOMYCES SP. [TaxId:60871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e5sa_
  • Chain 'B':
    Compound: proline oxidase
    Species: STREPTOMYCES SP. [TaxId:60871]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e5sb_
  • Heterogens: SO4, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5sA (A:)
    mrshilgkieldqtrlapdlaylaavptveeeydefsngfwkhvplwnasgdsedrlyrd
    lkdaaaqptahvehvpylkeivttvfdgthlqmarsrnlknaiviphrdfveldrevdry
    frtfmvledsplafhsnedtvihmrpgeiwfldaatvhsavnfseisrqslcvdfafdgp
    fdekeifadatlyapgstpdlperrpftaehrrrilslgqvierenfrdilfllskvhyk
    ydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsltsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5sA (A:)
    mrshilgkieldqtrlapdlaylaavptveefsngfwkhvplwnqptahvehvpylkeiv
    ttvfdgthlqmarsrnlknaiviphrdfryfrtfmvledsplafhsnedtvihmrpgeiw
    fldaatvhsavnfseisrqslcvdfafdgpfdekeifadatlyapgstpdlperrpftae
    hrrrilslgqvierenfrdilfllskvhykydvhpsetydwlieiskqagdekmvvkaeq
    irdfavearalserfsltsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5sB (B:)
    mrshilgkieldqtrlapdlaylaavptveeeydefsngfwkhvplwnasgdsedrlyrd
    lkdaaaqptahvehvpylkeivttvfdgthlqmarsrnlknaiviphrdfveldrevdry
    frtfmvledsplafhsnedtvihmrpgeiwfldaatvhsavnfseisrqslcvdfafdgp
    fdekeifadatlyapgstpdlperrpftaehrrrilslgqvierenfrdilfllskvhyk
    ydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsltsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5sB (B:)
    mrshilgkieldqtrlapdlaylaavptveefsngfwkhvplwnaptahvehvpylkeiv
    ttvfdgthlqmarsrnlknaiviphrdfvyfrtfmvledsplafhsnedtvihmrpgeiw
    fldaatvhsavnfseisrqslcvdfyapgstpdlperrpftaehrrrilslgqvierenf
    rdilfllskvhykydvhpsetydwlieiskqagdekmvvkaeqirdfavearalserfsl
    tsw