PDB entry 1e5q

View 1e5q on RCSB PDB site
Description: Ternary complex of saccharopine reductase from Magnaporthe grisea, NADPH and saccharopine
Class: oxidoreductase
Keywords: oxidoreductase, saccharopine reductase, nadph, lysine biosynthesis, alpha- aminoadipate pathway
Deposited on 2000-07-28, released 2000-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qa1, d1e5qa2
  • Chain 'B':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qb1, d1e5qb2
  • Chain 'C':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qc1, d1e5qc2
  • Chain 'D':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qd1, d1e5qd2
  • Chain 'E':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qe1, d1e5qe2
  • Chain 'F':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qf1, d1e5qf2
  • Chain 'G':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qg1, d1e5qg2
  • Chain 'H':
    Compound: Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]
    Species: Magnaporthe oryzae [TaxId:148305]
    Gene: LYS3, MGG_08564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1e5qh1, d1e5qh2
  • Heterogens: NDP, SHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5qA (A:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qA (A:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5qB (B:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qB (B:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e5qC (C:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qC (C:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e5qD (D:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qD (D:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e5qE (E:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qE (E:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e5qF (F:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qF (F:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e5qG (G:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qG (G:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e5qH (H:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5qH (H:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva