PDB entry 1e5p

View 1e5p on RCSB PDB site
Description: crystal structure of aphrodisin, a sex pheromone from female hamster
Class: lipocalin
Keywords: lipocalin, pheromone, hamster, crystal structure
Deposited on 2000-07-28, released 2001-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.194
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aphrodisin
    Species: Mesocricetus auratus [TaxId:10036]
    Gene: MESOCRICETUS AURATUS APHRODISIN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09465 (Start-150)
      • conflict (72)
      • modified residue (44)
      • modified residue (98)
      • modified residue (107)
    Domains in SCOPe 2.07: d1e5pa_
  • Chain 'B':
    Compound: aphrodisin
    Species: Mesocricetus auratus [TaxId:10036]
    Gene: MESOCRICETUS AURATUS APHRODISIN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09465 (Start-150)
      • conflict (72)
      • modified residue (44)
      • modified residue (98)
      • modified residue (107)
    Domains in SCOPe 2.07: d1e5pb_
  • Chain 'C':
    Compound: aphrodisin
    Species: Mesocricetus auratus [TaxId:10036]
    Gene: MESOCRICETUS AURATUS APHRODISIN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09465 (Start-150)
      • conflict (72)
      • modified residue (44)
      • modified residue (98)
      • modified residue (107)
    Domains in SCOPe 2.07: d1e5pc_
  • Chain 'D':
    Compound: aphrodisin
    Species: Mesocricetus auratus [TaxId:10036]
    Gene: MESOCRICETUS AURATUS APHRODISIN GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09465 (Start-150)
      • conflict (72)
      • modified residue (44)
      • modified residue (98)
      • modified residue (107)
    Domains in SCOPe 2.07: d1e5pd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5pA (A:)
    qdfaelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskt
    tvigylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltp
    eeneilvqfahekkipvenilnilatdtcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5pA (A:)
    faelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttv
    igylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpee
    neilvqfahekkipvenilnilatdtcpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5pB (B:)
    qdfaelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskt
    tvigylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltp
    eeneilvqfahekkipvenilnilatdtcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5pB (B:)
    aelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttvi
    gylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpeen
    eilvqfahekkipvenilnilatdtcpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e5pC (C:)
    qdfaelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskt
    tvigylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltp
    eeneilvqfahekkipvenilnilatdtcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5pC (C:)
    elqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttvig
    ylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpeene
    ilvqfahekkipvenilnilatdtcpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e5pD (D:)
    qdfaelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskt
    tvigylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltp
    eeneilvqfahekkipvenilnilatdtcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5pD (D:)
    faelqgkwytiviaadnlekieeggplrfyfrhidcykncsemeitfyvitnnqcskttv
    igylkgngtyetqfegnnifqplyitsdkifftnknmdragqetnmivvagkgnaltpee
    neilvqfahekkipvenilnilatdtcpe