PDB entry 1e5n

View 1e5n on RCSB PDB site
Description: E246C mutant of P fluorescens subsp. cellulosa xylanase A in complex with xylopentaose
Class: hydrolase
Keywords: glycosyl hydrolase, family 10, xylan degradation, hydrolase
Deposited on 2000-07-27, released 2000-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.19
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768
      • engineered mutation (246)
    Domains in SCOPe 2.07: d1e5na_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase A
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14768
      • engineered mutation (246)
    Domains in SCOPe 2.07: d1e5nb_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5nA (A:)
    nglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5nA (A:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5nB (B:)
    nglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsf
    tnsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqv
    kswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyyn
    dfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalspt
    lkikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrr
    ggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5nB (B:)
    glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
    nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
    swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
    fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
    kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
    gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg