PDB entry 1e5l

View 1e5l on RCSB PDB site
Description: apo saccharopine reductase from magnaporthe grisea
Class: oxidoreductase
Keywords: oxidoreductase, saccharopine reductase, lysine biosynthesis, alpha- aminoadipate pathway
Deposited on 2000-07-27, released 2000-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: saccharopine reductase
    Species: MAGNAPORTHE GRISEA [TaxId:148305]
    Gene: LYS3
    Database cross-references and differences (RAF-indexed):
    • PDB 1E5L (Start-449)
    Domains in SCOPe 2.07: d1e5la1, d1e5la2
  • Chain 'B':
    Compound: saccharopine reductase
    Species: MAGNAPORTHE GRISEA [TaxId:148305]
    Gene: LYS3
    Database cross-references and differences (RAF-indexed):
    • PDB 1E5L (Start-449)
    Domains in SCOPe 2.07: d1e5lb1, d1e5lb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5lA (A:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5lA (A:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5lB (B:)
    matksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvndda
    aldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvm
    neigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvl
    lalrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadn
    ivrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivsti
    vsnatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvml
    qhkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgv
    lapmnskindplmkelkekygieckekvva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5lB (B:)
    atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
    ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
    eigldpgidhlyaiktieevhaaggkiktflsycgglpapessdnplgykfswssrgvll
    alrnaasfykdgkvtnvagpelmatakpyfiypgfafvaypnrdstpykeryqipeadni
    vrgtlryqgfpqfikvlvdigflsdeeqpflkeaipwkeatqkivkassaseqdivstiv
    snatfesteeqkrivaglkwlgifsdkkitprgnaldtlcatleekmqfeegerdlvmlq
    hkfeienkdgsretrtsslceygapigsggysamaklvgvpcavavkfvldgtisdrgvl
    apmnskindplmkelkekygieckekvva