PDB entry 1e5k

View 1e5k on RCSB PDB site
Description: crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution
Class: molybdopterin nucleotidyl-transferase
Keywords: molybdopterin nucleotidyl-transferase,
Deposited on 2000-07-27, released 2000-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.184
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin-guanine dinucleotide biosynthesis protein a
    Species: Escherichia coli [TaxId:83333]
    Gene: MOBA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e5ka_
  • Heterogens: LI, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5kA (A:)
    mnlmttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqei
    yqasglkviedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkda
    pvvwvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvn
    vntpeelarwqekrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5kA (A:)
    mttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqa
    sglkviedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkdapvv
    wvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvnt
    peelarwq