PDB entry 1e5j

View 1e5j on RCSB PDB site
Description:
Deposited on 2000-07-26, released 2001-07-26
The last revision prior to the SCOP 1.61 freeze date was dated 2001-07-26, with a file datestamp of 2001-07-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1e5ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5jA (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
    amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
    as