PDB entry 1e5i

View 1e5i on RCSB PDB site
Description: delta-r306 deacetoxycephalosporin c synthase complexed with iron and 2-oxoglutarate.
Class: oxidoreductase
Keywords: ferrous oxygenase, cephalosporin, 2-oxoglutarate, c-terminus antibiotics, oxidoreductase, oxidative coupling control
Deposited on 2000-07-26, released 2001-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: CEFE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18548 (0-305)
      • see remark 999 (49)
    Domains in SCOPe 2.07: d1e5ia_
  • Heterogens: FE2, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5iA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdividffehgse
    aekravtspvptmrrgftglesestaqitntgsysdysmcysmgtadnlfpsgdferiwt
    qyfdrqytasravarevlratgtepdggveafldcepllrfryfpqvpehrsaeeqplrm
    aphydlsmvtliqqtpcangfvslqaevggaftdlpyrpdavlvfcgaiatlvtggqvka
    prhhvaaprrdqiagssrtssvfflrpnadftfsvplarecgfdvsldgetatfqdwigg
    nyvnir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5iA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdividffehgse
    aekravtspvptmrrgftglsmcysmgtadnlfpsgdferiwtqyfdrqytasravarev
    lratgtepdggveafldcepllrfryfpqlrmaphydlsmvtliqqtpcafvslqaevgg
    aftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaapsrtssvfflrpnadftfsvpla
    recgfdvsldgetatfqdwiggnyvnir