PDB entry 1e5h

View 1e5h on RCSB PDB site
Description: delta-r307a deacetoxycephalosporin c synthase complexed with succinate and carbon dioxide
Class: oxidoreductase
Keywords: ferrous oxygenase, cephalosporin, 2-oxoglutarate, c-terminus antibiotics, oxidoreductase, oxidative coupling control
Deposited on 2000-07-26, released 2001-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.22
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deacetoxycephalosporin c synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: CEFE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18548 (0-307)
      • conflict see remark 9 (49)
      • engineered mutation (307)
    Domains in SCOPe 2.07: d1e5ha_
  • Heterogens: FE2, SIN, CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5hA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdividffehgse
    aekravtspvptmrrgftglesestaqitntgsysdysmcysmgtadnlfpsgdferiwt
    qyfdrqytasravarevlratgtepdggveafldcepllrfryfpqvpehrsaeeqplrm
    aphydlsmvtliqqtpcangfvslqaevggaftdlpyrpdavlvfcgaiatlvtggqvka
    prhhvaaprrdqiagssrtssvfflrpnadftfsvplarecgfdvsldgetatfqdwigg
    nyvnirra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5hA (A:)
    mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdividffehgse
    aekravtspvptmrrgftgtgsysdysmcysmgtadnlfpsgdferiwtqyfdrqytasr
    avarevlratgtepdggveafldcepllrfryfplrmaphydlsmvtliqqtfvslqaev
    ggaftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaasrtssvfflrpnadftfsvpl
    arecgfdvsldgetatfqdwiggnyvnirra