PDB entry 1e5g

View 1e5g on RCSB PDB site
Description: Solution structure of central CP module pair of a pox virus complement inhibitor
Class: complement inhibitor
Keywords: complement inhibitor
Deposited on 2000-07-25, released 2000-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: complement control protein c3
  Species: VACCINIA VIRUS [TaxId:10249]
  Gene: C21L
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68639 (0-119)
  Domains in SCOPe 2.08: d1e5ga1, d1e5ga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e5gA (A:)
  rrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpeapic
  esvkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi