PDB entry 1e5f

View 1e5f on RCSB PDB site
Description: methionine gamma-lyase (mgl) from trichomonas vaginalis
Class: lyase
Keywords: methionine biosynthesis, plp-dependent enzymes, c-s gamma lyase, lyase
Deposited on 2000-07-25, released 2001-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.162
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: TRICHOMONAS VAGINALIS [TaxId:412133]
    Gene: MGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15564 (Start-395)
      • cloning artifact (307)
    • PDB 1E5F
    Domains in SCOPe 2.07: d1e5fa_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: TRICHOMONAS VAGINALIS [TaxId:412133]
    Gene: MGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15564 (Start-395)
      • cloning artifact (307)
    • PDB 1E5F
    Domains in SCOPe 2.07: d1e5fb_
  • Heterogens: PLP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5fA (A:)
    mahermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlg
    nptvsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfeh
    altkfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvl
    viadntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikdi
    tgsvisphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdi
    akkqmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpke
    ereaagitdgmirlsvgiedadeliadfkqgldallrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5fA (A:)
    ermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlgnpt
    vsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfehalt
    kfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvlvia
    dntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikditgs
    visphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdiakk
    qmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpkeere
    aagitdgmirlsvgiedadeliadfkqgldall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5fB (B:)
    mahermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlg
    nptvsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfeh
    altkfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvl
    viadntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikdi
    tgsvisphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdi
    akkqmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpke
    ereaagitdgmirlsvgiedadeliadfkqgldallrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5fB (B:)
    ermtpatacihanpqkdqfgaaippiyqtstfvfdncqqggnrfagqesgyiytrlgnpt
    vsnlegkiaflekteacvatssgmgaiaatvltilkagdhlisdeclygcthalfehalt
    kfgiqvdfintaipgevkkhmkpntkivyfetpanptlkiidmervckdahsqegvlvia
    dntfcspmitnpvdfgvdvvvhsatkyinghtdvvaglicgkadllqqirmvgikditgs
    visphdawlitrglstlnirmkaesenamkvaeylkshpavekvyypgfedheghdiakk
    qmrmygsmitfilksgfegakklldnlklitlavslggcesliqhpasmthavvpkeere
    aagitdgmirlsvgiedadeliadfkqgldall