PDB entry 1e5d

View 1e5d on RCSB PDB site
Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
Deposited on 2000-07-24, released 2000-11-17
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1794
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5dA (A:)
    mqatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgell
    cgiasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwp
    vqvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdq
    ipvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfav
    qkyveyaeqkptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimse
    isdagavivgspthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewlt
    gmgfdmpatpvkvknvpthadyeqlktmaqtiaralkaklaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5dA (A:)
    qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
    giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
    qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
    pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
    kyveyaeqkptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimsei
    sdagavivgspthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltg
    mgfdmpatpvkvknvpthadyeqlktmaqtiaralkaklaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5dB (B:)
    mqatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgell
    cgiasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwp
    vqvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdq
    ipvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfav
    qkyveyaeqkptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimse
    isdagavivgspthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewlt
    gmgfdmpatpvkvknvpthadyeqlktmaqtiaralkaklaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5dB (B:)
    qatkiidgfhlvgaidwnsrdfhgytlspmgttynaylvedekttlfdtvkaeykgellc
    giasvidpkkidylviqhleldhagalpalieacqpekiftsslgqkameshfhykdwpv
    qvvkhgetlslgkrtvtfyetrmlhwpdsmvswfadekvlisndifgqniaaserfsdqi
    pvhtleramreyyanivnpyapqtlkaietlvgagvapeficpdhgvifrgadqctfavq
    kyveyaeqkptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimsei
    sdagavivgspthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltg
    mgfdmpatpvkvknvpthadyeqlktmaqtiaralkaklaa