PDB entry 1e5a

View 1e5a on RCSB PDB site
Description: structure of human transthyretin complexed with bromophenols: a new mode of binding
Deposited on 2000-07-20, released 2000-08-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-29, with a file datestamp of 2000-08-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e5aa_
  • Chain 'B':
    Domains in SCOP 1.55: d1e5ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5aA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e5aB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp