PDB entry 1e58

View 1e58 on RCSB PDB site
Description: e.coli cofactor-dependent phosphoglycerate mutase
Class: isomerase
Keywords: phosphohistidine, glycolysis and gluconeogenesis, phosphoglycerate mutase, isomerase
Deposited on 2000-07-19, released 2001-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1209
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate mutase
    Species: Escherichia coli [TaxId:83333]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e58a_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e58A (A:)
    avtklvlvrhgesqwnkenrftgwydvdlsekgvseakaagkllkeegysfdfaytsvlk
    raihtlwnvldeldqawlpvekswklnerhygalqglnkaetaekygdeqvkqwrrgfav
    tppeltkdderypghdpryaklsekelplteslaltidrvipywnetilprmksgervii
    aahgnslralvkyldnmseeeilelniptgvplvyefdenfkplkryylgnadeiaakaa
    avanqgkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e58A (A:)
    avtklvlvrhgesqwnkenrftgwydvdlsekgvseakaagkllkeegysfdfaytsvlk
    raihtlwnvldeldqawlpvekswklnerhygalqglnkaetaekygdeqvkqwrrgfav
    tppeltkdderypghdpryaklsekelplteslaltidrvipywnetilprmksgervii
    aahgnslralvkyldnmseeeilelniptgvplvyefdenfkplkryylgnadeiaakaa
    avanqgk