PDB entry 1e56

View 1e56 on RCSB PDB site
Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta- glucosidase zmglue191d in complex with the natural substrate dimboa- beta-d-glucoside
Deposited on 2000-07-18, released 2000-12-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.228
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e56a_
  • Chain 'B':
    Domains in SCOP 1.55: d1e56b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e56A (A:)
    lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi
    gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen
    giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp
    qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd
    dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf
    fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp
    pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld
    yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa
    kwlkefnta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e56B (B:)
    lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi
    gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen
    giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp
    qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd
    dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf
    fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp
    pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld
    yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa
    kwlkefnta