PDB entry 1e55

View 1e55 on RCSB PDB site
Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta- glucosidase zmglue191d in complex with the competitive inhibitor dhurrin
Deposited on 2000-07-18, released 2000-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1e55a_
  • Chain 'B':
    Domains in SCOP 1.63: d1e55b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e55A (A:)
    vqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsn
    sdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinll
    lengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltf
    ndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhy
    krddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarer
    lpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkp
    igppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndyk
    rldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymk
    esakwlkefnta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e55B (B:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefnta