PDB entry 1e55

View 1e55 on RCSB PDB site
Description: Crystal structure of the inactive mutant Monocot (Maize ZMGlu1) beta-glucosidase ZMGluE191D in complex with the competitive inhibitor dhurrin
Class: hydrolase
Keywords: glycoside hydrolase, beta-glucosidase, family 1, retention of the anomeric configuration, inactive mutant e191d, complex with dhurrin, hydrolase
Deposited on 2000-07-18, released 2000-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: ZEA MAYS [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1e55a_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: ZEA MAYS [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1e55b_
  • Heterogens: BGC, DHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e55A (A:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e55A (A:)
    vqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsn
    sdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinll
    lengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltf
    ndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhy
    krddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarer
    lpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkp
    igppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndyk
    rldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymk
    esakwlkefnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e55B (B:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e55B (B:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefnta