PDB entry 1e54

View 1e54 on RCSB PDB site
Description: anion-selective porin from comamonas acidovorans
Deposited on 2000-07-17, released 2001-07-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-12, with a file datestamp of 2001-07-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e54a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e54A (A:)
    essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
    ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
    waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
    gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
    ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
    stlglqakgvyaggvqagesqtgvqvgirhaf