PDB entry 1e54

View 1e54 on RCSB PDB site
Description: anion-selective porin from comamonas acidovorans
Class: outer membrane protein
Keywords: outer membrane protein, anionen channel, channel protein, beta barrel
Deposited on 2000-07-17, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane porin protein 32
    Species: COMAMONAS ACIDOVORANS [TaxId:80866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24305 (0-331)
      • modification (0)
    Domains in SCOPe 2.07: d1e54a_
  • Chain 'B':
    Compound: omp32
    Species: COMAMONAS ACIDOVORANS [TaxId:80866]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E54 (0-7)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e54A (A:)
    essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
    ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
    waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
    gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
    ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
    stlglqakgvyaggvqagesqtgvqvgirhaf
    

  • Chain 'B':
    No sequence available.