PDB entry 1e53

View 1e53 on RCSB PDB site
Description: carboxy-terminal domain of human tfiih p44 subunit
Deposited on 2000-07-14, released 2000-10-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-24, with a file datestamp of 2000-10-24.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e53a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e53A (A:)
    ldafqeipleeyngerfcygcqgelkdqhvyvcavcqnvfcvdcdvfvhdslhccpgci