PDB entry 1e53

View 1e53 on RCSB PDB site
Description: carboxy-terminal domain of human tfiih p44 subunit
Class: transcription factor
Keywords: basic transcription factor, zinc binding protein
Deposited on 2000-07-14, released 2000-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-04-08, with a file datestamp of 2007-04-25.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tfiih p44 subunit
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAC52046 (0-58)
    Domains in SCOPe 2.08: d1e53a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e53A (A:)
    ldafqeipleeyngerfcygcqgelkdqhvyvcavcqnvfcvdcdvfvhdslhccpgci