PDB entry 1e52

View 1e52 on RCSB PDB site
Description: solution structure of escherichia coli uvrb c-terminal domain
Deposited on 2000-07-14, released 2001-07-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-12, with a file datestamp of 2001-07-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e52a_
  • Chain 'B':
    Domains in SCOP 1.57: d1e52b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e52A (A:)
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e52B (B:)
lepdnvpmdmspkalqqkiheleglmmqhaqnlefeeaaqirdqlhqlrelfiaas