PDB entry 1e51

View 1e51 on RCSB PDB site
Description: crystal structure of native human erythrocyte 5-aminolaevulinic acid dehydratase
Deposited on 2000-07-13, released 2001-07-12
The last revision prior to the SCOP 1.61 freeze date was dated 2001-07-12, with a file datestamp of 2001-07-12.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.213
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e51a_
  • Chain 'B':
    Domains in SCOP 1.61: d1e51b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e51A (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e51A (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsgafraeesrqrlaevalayakagcqvvapsdmmdgrveaikeal
    mahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdrdv
    regadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaavle
    amtafrragadiiityytpqllqwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e51B (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e51B (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdadseespaieaihllrktfpnllvacdvclcp
    yaeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnrvsvmsysakfa
    scfygpfrdaarrcyqlppgarglalravdrdvregadmlmvkpgmpyldivrevkdkhp
    dlplavyhvsgefamlwhgaqagafdlkaavleamtafrragadiiityytpqllqwlk