PDB entry 1e4x

View 1e4x on RCSB PDB site
Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Class: immune system
Keywords: immune system, complex (antibody/antigen), cross-reactivity, protein-peptide recognition
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.06: d1e4xh1, d1e4xh2
  • Chain 'I':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.06: d1e4xi1, d1e4xi2
  • Chain 'L':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E4X (0-6)
    Domains in SCOPe 2.06: d1e4xl1, d1e4xl2
  • Chain 'M':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E4X (0-6)
    Domains in SCOPe 2.06: d1e4xm1, d1e4xm2
  • Chain 'P':
    Compound: cyclic peptide
  • Chain 'Q':
    Compound: cyclic peptide
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e4xH (H:)
    qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
    nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4xH (H:)
    qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
    nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4xI (I:)
    qvqlqqpgaelvkpgpsvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
    nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvpi
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4xL (L:)
    diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
    rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4xM (M:)
    diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
    rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.